HORDB

ID: hor004576
Uniprot ID: P63313
Protein name: Thymosin beta-10
Gene name: TMSB10
Organism: Homo sapiens (Human)
Family: Thymosin beta family
Source: Human
Expression: Found to decrease dramatically after birth.
Disease: Diseases associated with TMSB10 include Diamond-Blackfan Anemia 5 and Pancreatic Cancer.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003779 actin binding; GO:0003785 actin monomer binding; GO:0005515 protein binding
GO BP: GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
GO CC: GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Length: 43
Propeptide: MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Signal peptide: NA
Modification: T1 N-acetylalanine;T3 N6-acetyllysine;T11 Phosphoserine;T14 N6-acetyllysine;T20 Phosphothreonine;T22 Phosphothreonine;T33 Phosphothreonine;T38 N6-acetyllysine;T40 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the organization of the cytoskeleton.
Mechanism: Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004576_AF2.pdb

hor004576_ESM.pdb

Mass:	564380	Formula:	C209H351N57O75S
Absent amino acids:	CHVWY	Common amino acids:	K
pI:	5.02	Basic residues:	9
Polar residues:	10	Hydrophobic residues:	9
Hydrophobicity:	-138.37	Boman Index:	-13762
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	52.33
Instability Index:	5762.79	Extinction Coefficient cystines:	0
Absorbance 280nm:	0